Name :
Human Siglec9/CD329 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant
Description :
Myeloid cell surface antigen CD329, also known as CDw329, FOAP-9 and SIGLEC-9, is a single-pass type I transmembrane protein belonging to the sialic acid binding Ig-like lectin (SIGLEC) family in the immunoglobulin superfamily (IgSF). SIGLECs are characterized by an N-terminal Ig-like V-type domain that mediates sialic acid binding, followed by varying numbers (2 to 17) of Ig-like C2-type domains, a transmembrane region, and a cytoplasmic tail with intracellular immunoreceptor tyrosine-based inhibitory motifs (ITIM). They can be classified into two subgroups: SIGLEC-1, -2, and -4 subgroup, and a SIGLEC-3/CD33-related subgroup (SIGLEC-3, and -5 through -13), defined by sequence similarity and clustered gene localization. SIGLECs are widely expressed on hematopoietic cells, often in a cell-type-specific manner. CD329/SIGLEC9 is expressed on neutrophils, monocytes, a fraction of NK cells, B cells, and a minor subset of CD8+ T cells. It is also found in liver, fetal liver, bone marrow, placenta, spleen and in lower levels in skeletal muscle, fetal brain, stomach, lung, thymus, prostate, brain, mammary, adrenal gland, colon, trachea, cerebellum, testis, small intestine and spinal cordon. Unlike CD33, CD329/SIGLEC-9 binds equally well to both 2,3 and 2,6linked sialic acid. CD329/SIGLEC-9 contains 2 Ig-like C2-type and 1 Ig-like V-type domains in the extracellular region and a cytoplasmic immunoreceptor tyrosine-based inhibitor motif (ITIM). CD329/Siglec9 is closely related to CD328/Siglec7, and they share ~80% amino acid sequence identity. CD329/SLGLEC-9 may function as a putative adhesion molecule that mediates sialic-acid dependent binding to cells.
Gene Symbol :
The recombinant human CD329-Fc is expressed as a 556 amino acid protein consisting of Gln18 – Gly348 region of CD329 and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
NCBI Gene ID :
27180
Uniprot Entry :
Q9Y336
Construct Details :
The recombinant human CD329-Fc is expressed as a 556 amino acid protein consisting of Gln18 – Gly348 region of CD329 and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source :
Human cells stably expressing human CD329-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
QTSKLLTMQSSVTVQEGLCVHVPCSFSYPSHGWIYPGPVVHGYWFREGANTDQDA PVATNNPARAVWEETRDRFHLLGDPHTKNCTLSIRDARRSDAGRYFFRMEKGSIK WNYKHHRLSVNVTALTHRPNILIPGTLESGCPQNLTCSVPWACEQGTPPMISWIG TSVSPLDPSTTRSSVLTLIPQPQDHGTSLTCQVTFPGASVTTNKTVHLNVSYPPQ NLTMTVFQGDGTVSTVLGNGSSLSLPEGQSLRLVCAVDAVDSNPPARLSLSWRGL TLCPSQPSNPGVLELPWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQ GTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAP IEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPGK
M.W. :
Calculated molecular mass (kDa): 61.4; Estimated by SDS-PAGE under reducing condition (kDa): 80-90 (probably due to glycosylation)
Calculated PI :
7.90
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 90840
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Immobilized protein supports the adhesion of human red blood cells. Blocks CD329-binding to its ligand and signaling activity.
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD329; CDw329; FOAP-9; Siglec9; Siglec-9; OBBP-LIKE; UNQ668/PRO1302
Research Area :
Hematology
Pathway/Disease :
Cell Adhesion
Species :
Human
CD Antigen :
CD329
References :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Ephrin-A5/EFNA5 Protein
FGF-12 Protein
Popular categories:
CCR9
CEA Cell Adhesion Molecule 19 (CEACAM19)
